PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr019289.1
Common NameLOC103964998
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 351aa    MW: 39700.6 Da    PI: 6.1775
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr019289.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM182.21.2e-56161411128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhPtdeel+++yL++kv ++ + + ++i evd++k+ePwdLp+++k +e+ewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++  ++
  Pbr019289.1  16 LPPGFRFHPTDEELISHYLCPKVLDNFFCA-KAIGEVDLNKCEPWDLPRRAKMGEREWYFFCVRDRKYPTGLRTNRATEAGYWKATGKDKEIYK-AKT 111
                  79************************9888.89***************99999*****************************************.999 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  lvg+kktLvfykgrapkgekt+Wvmheyrl
  Pbr019289.1 112 LVGMKKTLVFYKGRAPKGEKTNWVMHEYRL 141
                  ****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.15E-6412166IPR003441NAC domain
PROSITE profilePS5100559.83716166IPR003441NAC domain
PfamPF023653.2E-3017141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MENTSGFINV DEQMELPPGF RFHPTDEELI SHYLCPKVLD NFFCAKAIGE VDLNKCEPWD  60
LPRRAKMGER EWYFFCVRDR KYPTGLRTNR ATEAGYWKAT GKDKEIYKAK TLVGMKKTLV  120
FYKGRAPKGE KTNWVMHEYR LDGKNSACNL PQTAKNEWVI CRIFQKSSGG KKIHISGLVR  180
LSPFGNELRS SLLPPLMDSP PYNSDARTTP TAGETSYVSC FSDPPEDQKT QDDIMDSFNN  240
GNNHHNNDIP YACSSPSNPS SDLNSIYSNQ ITPNIGLLQH QNSVLMQDES FMRMLTENQA  300
PNLRRSAKIE FPQDAGLSID ASSVVSNREM AQDDPSYSSA PVEFDCLWNY *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B5e-571317214171NAC domain-containing protein 19
4dul_A5e-571317214171NAC domain-containing protein 19
1ut7_B5e-571317214171NO APICAL MERISTEM PROTEIN
1ut7_A5e-571317214171NO APICAL MERISTEM PROTEIN
1ut4_B5e-571317214171NO APICAL MERISTEM PROTEIN
1ut4_A5e-571317214171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF8037370.0JF803737.1 Pyrus betulifolia cultivar Bunge NAC domain protein DL-NACP mRNA, complete cds.
GenBankJF8037380.0JF803738.1 Pyrus x bretschneideri cultivar Yali NAC domain protein YL-NACP mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001289216.10.0NAC domain-containing protein 100-like
SwissprotQ9FLJ21e-131NC100_ARATH; NAC domain-containing protein 100
TrEMBLI3VI190.0I3VI19_9R
TrEMBLI3VI180.0I3VI18_9R
STRINGVIT_14s0108g01070.t011e-154(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-123NAC domain containing protein 100